General Information

  • ID:  hor001925
  • Uniprot ID:  P16613
  • Protein name:  Pituitary adenylate cyclase-activating polypeptide 38
  • Gene name:  ADCYAP1
  • Organism:  Ovis aries (Sheep)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0016521 pituitary adenylate cyclase activating polypeptide activity; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007218 neuropeptide signaling pathway; GO:0007399 nervous system development; GO:0008277 regulation of G protein-coupled receptor signaling pathway; GO:0010628 positive regulation of gene expression; GO:0019933 cAMP-mediated signaling; GO:0030073 insulin secretion; GO:0031175 neuron projection development; GO:0032880 regulation of protein localization; GO:0043547 positive regulation of GTPase activity; GO:0045860 positive regulation of protein kinase activity; GO:0045944 positive regulation of transcription by RNA polymerase II; GO:0060124 positive regulation of growth hormone secretion; GO:0070374 positive regulation of ERK1 and ERK2 cascade
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
  • Length:  38
  • Propeptide:  MTMCSGARLALLVYGILMHSSVYGSPAASGLRFPGIRPENEAYDEDGNPQQDFYDSEPPGVGSPASALRDAYALYYPAEERDVAHGILDKAYRKVLDQLSARRYLQTLMAKGLGGTPGGGADDDSEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIPYL
  • Signal peptide:  MTMCSGARLALLVYGILMHSSVYG
  • Modification:  T27 Leucine amide;T38 Lysine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Binding to its receptor activates G proteins and stimulates adenylate cyclase in pituitary cells. Promotes neuron projection development through the RAPGEF2/Rap2/B-Raf/ERK pathway. In chromaffin cells, induces long-lasting increase of intracellular calcium concentrations and neuroendocrine secretion. Involved in the control of glucose homeostasis, induces insulin secretion by pancreatic beta cells.
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  NA
  • Target Unid:  NA
  • IC50: IC50 = 7.7±1.4 nM ( PubMed ID: 18353507 )
  • EC50: 6.5±0.8nM
  • ED50: NA
  • kd: NA
  • Half life: 23±6 minutes; /1380 seconds ( PubMed ID: 18353507 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P16613-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001925_AF2.pdbhor001925_ESM.pdb

Physical Information

Mass: 519543 Formula: C203H330N62O54S
Absent amino acids: CEPW Common amino acids: K
pI: 11.01 Basic residues: 12
Polar residues: 11 Hydrophobic residues: 10
Hydrophobicity: -106.05 Boman Index: -11216
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 61.58
Instability Index: 3599.21 Extinction Coefficient cystines: 5960
Absorbance 280nm: 161.08

Literature